PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016488301.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 866aa    MW: 98299.9 Da    PI: 9.7223
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016488301.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B336.11.2e-11381171398
                     TT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3  13 sgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                      +rl++p +fa+++ ++  ++  + le +sg++Wev++    ++gr+ l+ GW++F +   +  g f++F ++ rs f  +v++f+
  XP_016488301.1  38 CSRLRIPEDFASKYCKNMLNP--VYLEVPSGEVWEVEV--VHSQGRICLGIGWQDFSDFYSISCGHFLIFGYNARSHF--NVTIFD 117
                     468***********5454444..***************..999999**************************999999..999987 PP

2B3438.3e-14263345492
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                      + ps+v++  +l++p kfa+++ +++ +   l+l  +   sW+vk+++  +  +++    Wk Fv +n+Lk gD++vF++++ ++  +
  XP_016488301.1 263 FMQPSYVFSPFNLSMPLKFARKYFLENYG--NLVLHVPGRGSWSVKCTFGTTNAKIF----WKAFVMDNKLKPGDVCVFEVIKGTKLLM 345
                     6889*******************877655..6***************8866655554....*******************887555444 PP

3B348.71.4e-15507594697
                     ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                      ps+v+k  +l ++ +fa+++  ++ +    +l+ +   sW+v++ + ++s+   +++GWk Fv++n+Lk gD++vF++++ ++  + v++f
  XP_016488301.1 507 QPSYVSKPYNLNISATFAKKYFRDEYS--NFVLRVPGRGSWSVEC-FLGTSK-AQIRSGWKAFVQDNKLKYGDVCVFEVIKVTKLLMDVTIF 594
                     6899*****************777555..69**************.444443.459**********************99877776666666 PP

4B341.82e-13759849599
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                     + ps+vl+  rl ++  fa+++  +k ++  l+l+ +   sW+vk+i  k++ ++ +   Wk Fv +n+Lk gD++vF+l++ ++  l v++fr+
  XP_016488301.1 759 MQPSYVLTPYRLDISFLFARKYVWEK-CG-FLVLRVPGRGSWSVKYILGKSKTKICFY--WKAFVLDNKLKFGDVCVFELIKGTKPILDVTIFRT 849
                     6799******************5443.43.6999******************999999..*********************88777788888885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.4E-1722119IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.69E-1725119IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.03926119IPR003340B3 DNA binding domain
CDDcd100173.68E-1126117No hitNo description
SMARTSM010191.2E-829119IPR003340B3 DNA binding domain
PfamPF023622.5E-839117IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.2E-16253347IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.94E-16255350IPR015300DNA-binding pseudobarrel domain
CDDcd100179.24E-17258351No hitNo description
SMARTSM010192.0E-10260353IPR003340B3 DNA binding domain
PROSITE profilePS508639.756260353IPR003340B3 DNA binding domain
PfamPF023622.3E-11262343IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.4E-21494595IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.46E-19495594IPR015300DNA-binding pseudobarrel domain
CDDcd100179.41E-15500595No hitNo description
SMARTSM010191.0E-11501597IPR003340B3 DNA binding domain
PROSITE profilePS5086312.055502597IPR003340B3 DNA binding domain
PfamPF023622.0E-12506594IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.5E-17747848IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.69E-18748848IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.588755850IPR003340B3 DNA binding domain
SMARTSM010193.5E-9758850IPR003340B3 DNA binding domain
CDDcd100174.64E-15759848No hitNo description
PfamPF023621.8E-10759848IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 866 aa     Download sequence    Send to blast
MAAKPHLQSG EGSSHWKSST AKIPQPKFFK IIFFQHECSR LRIPEDFASK YCKNMLNPVY  60
LEVPSGEVWE VEVVHSQGRI CLGIGWQDFS DFYSISCGHF LIFGYNARSH FNVTIFDLSA  120
SEIEYPYSSA HGIHTPISYS HETRHAQERD QSESDHSVEI HEVIPRSQKA NTITPDMVEN  180
SVENLDHCPL GQSSKRQRQG DAEDVASPSF IRKGQKSSEG CCTHMQQSKI VYDENKTVMD  240
KERAIAYRRA KGFKSKNPFI ISFMQPSYVF SPFNLSMPLK FARKYFLENY GNLVLHVPGR  300
GSWSVKCTFG TTNAKIFWKA FVMDNKLKPG DVCVFEVIKG TKLLMDITIF PAAGEVPGVS  360
DSSVPLSQSR IAQTKNLKQR RGGACGFNSK VKEEHGEGTG NEHSFEILGH CPLVQYRKRK  420
RLERDAEDDV PIDIHTKNIK VETSHKDVTL PSFRKIKKSG ESCRMHKQQT MIVCGKNKAG  480
MNKERAMAYQ RAKAFKSKNP FIISFIQPSY VSKPYNLNIS ATFAKKYFRD EYSNFVLRVP  540
GRGSWSVECF LGTSKAQIRS GWKAFVQDNK LKYGDVCVFE VIKVTKLLMD VTIFPAAGST  600
PILKIAGEVP GVSDSKRKII NTDIYVPCSP PKVVHTNRLK QRRGEEHDEG TGIESSAEIL  660
GHCPLGHDRK IKRLEEETED DVSIDIHTKS IKVANTQEDV ASPSFTRKTK KSGESCQMDK  720
QQSKMVYDKN TTVLDKERTV AYQRAKAFKS ENPYVMYFMQ PSYVLTPYRL DISFLFARKY  780
VWEKCGFLVL RVPGRGSWSV KYILGKSKTK ICFYWKAFVL DNKLKFGDVC VFELIKGTKP  840
ILDVTIFRTA ESKPIHKIDG KLPGLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A4e-1423685123144B3 domain-containing transcription factor VRN
4i1k_B4e-1423685123144B3 domain-containing transcription factor VRN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016488301.10.0PREDICTED: putative B3 domain-containing protein Os03g0621600 isoform X2
TrEMBLK4B4X60.0K4B4X6_SOLLC; Uncharacterized protein
STRINGSolyc02g021260.1.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.11e-34B3 family protein